Listing Thumbnail

    msa-search

     Info
    Sold by: NVIDIA 
    Deployed on AWS
    Free Trial
    NOTE: This deployment requires a specific SageMaker Inference AMI selection (al2-ami-sagemaker-inference-gpu-3-1). Please use the example notebook provided at https://github.com/NVIDIA/digital-biology-examples/blob/main/examples/nims/msa-search/nim-msa-search-v2-1-0_aws_marketplace.ipynb for deploying the endpoint. Generates a multiple sequence alignment from a query sequence and a protein sequence database search.

    Overview

    The MSA search NIM is powered by GPU MMSeqs2. GPU MMSeqs2 is a GPU-accelerated toolkit for protein database search and Multiple Sequence Alignment (MSA). While not a deep learning model, MMSeqs2 does require large protein databases for sequence similarity search.

    The MSA Search NIM enables researchers and commercial entities in the Drug Discovery, Life Sciences, and Digital Biology fields to rapidly generate multiple sequence alignments (MSA). The output MSA can be used in downstream protein structure prediction and evolutionary analysis applications.

    Highlights

    • The MSA Search NIM is based on GPU MMSeqs2, a highly-sensitive, highly-performant, GPU-accelerated package for a variety of sequence-alignment tasks. The NIM accuracy should match that of the open-source version of MMSeqs2 in most settings.

    Details

    Sold by

    Delivery method

    Latest version

    Deployed on AWS
    New

    Introducing multi-product solutions

    You can now purchase comprehensive solutions tailored to use cases and industries.

    Multi-product solutions

    Features and programs

    Financing for AWS Marketplace purchases

    AWS Marketplace now accepts line of credit payments through the PNC Vendor Finance program. This program is available to select AWS customers in the US, excluding NV, NC, ND, TN, & VT.
    Financing for AWS Marketplace purchases

    Pricing

    Free trial

    Try this product free for 31 days according to the free trial terms set by the vendor.
    Pricing is based on actual usage, with charges varying according to how much you consume. Subscriptions have no end date and may be canceled any time.
    Additional AWS infrastructure costs may apply. Use the AWS Pricing Calculator  to estimate your infrastructure costs.

    Usage costs (9)

     Info
    Dimension
    Description
    Cost/host/hour
    ml.g5.12xlarge Inference (Batch)
    Recommended
    Model inference on the ml.g5.12xlarge instance type, batch mode
    $1.00
    ml.g6e.12xlarge Inference (Real-Time)
    Recommended
    Model inference on the ml.g6e.12xlarge instance type, real-time mode
    $1.00
    ml.g6e.24xlarge Inference (Real-Time)
    Model inference on the ml.g6e.24xlarge instance type, real-time mode
    $1.00
    ml.g6e.48xlarge Inference (Real-Time)
    Model inference on the ml.g6e.48xlarge instance type, real-time mode
    $1.00
    ml.p4d.24xlarge Inference (Real-Time)
    Model inference on the ml.p4d.24xlarge instance type, real-time mode
    $1.00
    ml.p4de.24xlarge Inference (Real-Time)
    Model inference on the ml.p4de.24xlarge instance type, real-time mode
    $1.00
    ml.p5.48xlarge Inference (Real-Time)
    Model inference on the ml.p5.48xlarge instance type, real-time mode
    $1.00
    ml.p5e.48xlarge Inference (Real-Time)
    Model inference on the ml.p5e.48xlarge instance type, real-time mode
    $1.00
    ml.p5en.48xlarge Inference (Real-Time)
    Model inference on the ml.p5en.48xlarge instance type, real-time mode
    $1.00

    AI Insights

     Info

    Dimensions summary

    You pay by the host hour based on the AWS instance type you run for protein sequence alignment. One option, ml.g5.12xlarge, runs in batch mode for processing groups of sequences together. The other eight options run in real-time mode for on-demand requests. These span the g6e, p4d, p4de, p5, p5e, and p5en instance families. Larger instance sizes carry more GPU and memory capacity, so cost scales with the instance you choose. You are billed only for the hours each instance runs.

    Top-of-mind questions for buyers

    One host hour is one hour that a single instance of the chosen type runs the inference workload. You are billed per running instance-hour, not per sequence searched or per request. Cost accrues while the instance is active regardless of how many alignments you process during that hour.
    The ml.g5.12xlarge batch option processes groups of sequences together in scheduled runs. The eight real-time options handle requests on demand as they arrive. Both bill by host hour on their instance type. Choose batch for bulk processing and real-time for interactive, request-driven alignment.
    Software charges apply per host hour while the instance runs. A stopped instance does not accrue host-hour charges. Underlying AWS infrastructure fees, such as storage, may still apply separately depending on your setup. The software meter counts running time only.
    docs.nvidia.com
    Helpful?

    Vendor refund policy

    None

    How can we make this page better?

    Tell us how we can improve this page, or report an issue with this product.
    Tell us how we can improve this page, or report an issue with this product.

    Legal

    Vendor terms and conditions

    Upon subscribing to this product, you must acknowledge and agree to the terms and conditions outlined in the vendor's End User License Agreement (EULA) .

    Content disclaimer

    Vendors are responsible for their product descriptions and other product content. AWS does not warrant that vendors' product descriptions or other product content are accurate, complete, reliable, current, or error-free.

    Usage information

     Info

    Delivery details

    Amazon SageMaker model

    An Amazon SageMaker model package is a pre-trained machine learning model ready to use without additional training. Use the model package to create a model on Amazon SageMaker for real-time inference or batch processing. Amazon SageMaker is a fully managed platform for building, training, and deploying machine learning models at scale.

    Deploy the model on Amazon SageMaker AI using the following options:
    Deploy the model as an API endpoint for your applications. When you send data to the endpoint, SageMaker processes it and returns results by API response. The endpoint runs continuously until you delete it. You're billed for software and SageMaker infrastructure costs while the endpoint runs. AWS Marketplace models don't support Amazon SageMaker Asynchronous Inference. For more information, see Deploy models for real-time inference  .
    Deploy the model to process batches of data stored in Amazon Simple Storage Service (Amazon S3). SageMaker runs the job, processes your data, and returns results to Amazon S3. When complete, SageMaker stops the model. You're billed for software and SageMaker infrastructure costs only during the batch job. Duration depends on your model, instance type, and dataset size. AWS Marketplace models don't support Amazon SageMaker Asynchronous Inference. For more information, see Batch transform for inference with Amazon SageMaker AI  .

    Additional details

    Inputs

    Summary

    The model accepts JSON requests with parameters on /invocations and /ping APIs that can be used to control the generated text. See examples and field descriptions below.

    Input MIME type
    application/json
    payload = { "sequence": ( "MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN" ), "e_value": 0.0001, "iterations": 2, "databases": ["Uniref30_2302", "colabfold_envdb_202108", "PDB70_220313"], }

    Custom attributes

    The following table describes custom attributes for real-time inference endpoints.

    Field name
    Description
    Constraints
    Required
    paired
    Run the paired MSA calculations
    runtime = boto3.client('sagemaker-runtime', region_name='us-east-1') # Test single r1 = runtime.invoke_endpoint( EndpointName=ENDPOINT_NAME, ContentType='application/json', Body=json.dumps({"sequence": "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG"}) ) print(f"Single MSA: {len(r1['Body'].read())} bytes ✅") # Test paired r2 = runtime.invoke_endpoint( EndpointName='MSA-Search-NIM-v2-1-0-fix4', ContentType='application/json', Body=json.dumps({"sequences": ["MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG", "MHHHHHHSSGVDLGTENLYFQSNAM"]}), CustomAttributes='route=paired' ) print(f"Paired MSA: {len(r2['Body'].read())} bytes ✅")
    No

    Support

    Vendor support

    Free support via NVIDIA NIM Developer Forum:

    AWS infrastructure support

    AWS Support is a one-on-one, fast-response support channel that is staffed 24x7x365 with experienced and technical support engineers. The service helps customers of all sizes and technical abilities to successfully utilize the products and features provided by Amazon Web Services.

    Similar products

    Customer reviews

    Ratings and reviews

     Info
    0 ratings
    5 star
    4 star
    3 star
    2 star
    1 star
    0%
    0%
    0%
    0%
    0%
    0 reviews
    No customer reviews yet
    Be the first to review this product . We've partnered with PeerSpot to gather customer feedback. You can share your experience by writing or recording a review, or scheduling a call with a PeerSpot analyst.