Overview
The MSA search NIM is powered by GPU MMSeqs2. GPU MMSeqs2 is a GPU-accelerated toolkit for protein database search and Multiple Sequence Alignment (MSA). While not a deep learning model, MMSeqs2 does require large protein databases for sequence similarity search.
The MSA Search NIM enables researchers and commercial entities in the Drug Discovery, Life Sciences, and Digital Biology fields to rapidly generate multiple sequence alignments (MSA). The output MSA can be used in downstream protein structure prediction and evolutionary analysis applications.
Highlights
- The MSA Search NIM is based on GPU MMSeqs2, a highly-sensitive, highly-performant, GPU-accelerated package for a variety of sequence-alignment tasks. The NIM accuracy should match that of the open-source version of MMSeqs2 in most settings.
Details
Introducing multi-product solutions
You can now purchase comprehensive solutions tailored to use cases and industries.
Features and programs
Financing for AWS Marketplace purchases
Pricing
Free trial
Dimension | Description | Cost/host/hour |
|---|---|---|
ml.g5.12xlarge Inference (Batch) Recommended | Model inference on the ml.g5.12xlarge instance type, batch mode | $1.00 |
ml.g6e.12xlarge Inference (Real-Time) Recommended | Model inference on the ml.g6e.12xlarge instance type, real-time mode | $1.00 |
ml.g6e.24xlarge Inference (Real-Time) | Model inference on the ml.g6e.24xlarge instance type, real-time mode | $1.00 |
ml.g6e.48xlarge Inference (Real-Time) | Model inference on the ml.g6e.48xlarge instance type, real-time mode | $1.00 |
ml.p4d.24xlarge Inference (Real-Time) | Model inference on the ml.p4d.24xlarge instance type, real-time mode | $1.00 |
ml.p4de.24xlarge Inference (Real-Time) | Model inference on the ml.p4de.24xlarge instance type, real-time mode | $1.00 |
ml.p5.48xlarge Inference (Real-Time) | Model inference on the ml.p5.48xlarge instance type, real-time mode | $1.00 |
ml.p5e.48xlarge Inference (Real-Time) | Model inference on the ml.p5e.48xlarge instance type, real-time mode | $1.00 |
ml.p5en.48xlarge Inference (Real-Time) | Model inference on the ml.p5en.48xlarge instance type, real-time mode | $1.00 |
Vendor refund policy
None
How can we make this page better?
Legal
Vendor terms and conditions
Content disclaimer
Delivery details
Amazon SageMaker model
An Amazon SageMaker model package is a pre-trained machine learning model ready to use without additional training. Use the model package to create a model on Amazon SageMaker for real-time inference or batch processing. Amazon SageMaker is a fully managed platform for building, training, and deploying machine learning models at scale.
Version release notes
Additional details
Inputs
- Summary
The model accepts JSON requests with parameters on /invocations and /ping APIs that can be used to control the generated text. See examples and field descriptions below.
- Input MIME type
- application/json
Custom attributes
The following table describes custom attributes for real-time inference endpoints.
Field name | Description | Constraints | Required |
|---|---|---|---|
paired | Run the paired MSA calculations | runtime = boto3.client('sagemaker-runtime', region_name='us-east-1')
# Test single
r1 = runtime.invoke_endpoint(
EndpointName=ENDPOINT_NAME,
ContentType='application/json',
Body=json.dumps({"sequence": "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG"})
)
print(f"Single MSA: {len(r1['Body'].read())} bytes ✅")
# Test paired
r2 = runtime.invoke_endpoint(
EndpointName='MSA-Search-NIM-v2-1-0-fix4',
ContentType='application/json',
Body=json.dumps({"sequences": ["MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG", "MHHHHHHSSGVDLGTENLYFQSNAM"]}),
CustomAttributes='route=paired'
)
print(f"Paired MSA: {len(r2['Body'].read())} bytes ✅")
| No |
Resources
Support
Vendor support
Free support via NVIDIA NIM Developer Forum:
AWS infrastructure support
AWS Support is a one-on-one, fast-response support channel that is staffed 24x7x365 with experienced and technical support engineers. The service helps customers of all sizes and technical abilities to successfully utilize the products and features provided by Amazon Web Services.
Similar products
